Lineage for d2einh1 (2ein H:7-85)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642471Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 642472Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 642473Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)
  6. 642474Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 642475Species Cow (Bos taurus) [TaxId:9913] [47697] (14 PDB entries)
  8. 642498Domain d2einh1: 2ein H:7-85 [132259]
    Other proteins in same PDB: d2eina1, d2einb1, d2einb2, d2einc1, d2eind1, d2eine1, d2einf1, d2eing1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2einn1, d2eino1, d2eino2, d2einp1, d2einq1, d2einr1, d2eins1, d2eint1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1
    automatically matched to d1ocrh_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2einh1

PDB Entry: 2ein (more details), 2.7 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (H:) Cytochrome c oxidase subunit VIb isoform 1

SCOP Domain Sequences for d2einh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2einh1 a.51.1.1 (H:7-85) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOP Domain Coordinates for d2einh1:

Click to download the PDB-style file with coordinates for d2einh1.
(The format of our PDB-style files is described here.)

Timeline for d2einh1: