Lineage for d2eine1 (2ein E:5-109)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647493Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 647494Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 647495Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 647496Species Cow (Bos taurus) [TaxId:9913] [48482] (14 PDB entries)
  8. 647519Domain d2eine1: 2ein E:5-109 [132256]
    Other proteins in same PDB: d2eina1, d2einb1, d2einb2, d2einc1, d2eind1, d2einf1, d2eing1, d2einh1, d2eini1, d2einj1, d2eink1, d2einl1, d2einm1, d2einn1, d2eino1, d2eino2, d2einp1, d2einq1, d2eins1, d2eint1, d2einu1, d2einv1, d2einw1, d2einx1, d2einy1, d2einz1
    automatically matched to d1occe_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eine1

PDB Entry: 2ein (more details), 2.7 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (E:) Cytochrome c oxidase polypeptide Va

SCOP Domain Sequences for d2eine1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eine1 a.118.11.1 (E:5-109) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOP Domain Coordinates for d2eine1:

Click to download the PDB-style file with coordinates for d2eine1.
(The format of our PDB-style files is described here.)

Timeline for d2eine1: