Lineage for d2einb2 (2ein B:1-90)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059011Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 1059033Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 1059034Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 1059060Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 1059061Species Cow (Bos taurus) [TaxId:9913] [81454] (14 PDB entries)
  8. 1059082Domain d2einb2: 2ein B:1-90 [132253]
    Other proteins in same PDB: d2eina_, d2einb1, d2einc_, d2eind_, d2eine_, d2einf_, d2eing_, d2einh_, d2eini_, d2einj_, d2eink_, d2einl_, d2einm_, d2einn_, d2eino1, d2einp_, d2einq_, d2einr_, d2eins_, d2eint_, d2einu_, d2einv_, d2einw_, d2einx_, d2einy_, d2einz_
    automatically matched to d1occb2
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2einb2

PDB Entry: 2ein (more details), 2.7 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2einb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2einb2 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d2einb2:

Click to download the PDB-style file with coordinates for d2einb2.
(The format of our PDB-style files is described here.)

Timeline for d2einb2: