Lineage for d2eimz_ (2eim Z:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1697998Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) (S)
    automatically mapped to Pfam PF02285
  5. 1697999Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)
  6. 1698019Protein automated matches [190273] (1 species)
    not a true protein
  7. 1698020Species Cow (Bos taurus) [TaxId:9913] [187065] (18 PDB entries)
  8. 1698053Domain d2eimz_: 2eim Z: [132250]
    Other proteins in same PDB: d2eima_, d2eimb1, d2eimb2, d2eimc_, d2eimd_, d2eime_, d2eimf_, d2eimg_, d2eimh_, d2eimi_, d2eimj_, d2eimk_, d2eiml_, d2eimn_, d2eimo1, d2eimo2, d2eimp_, d2eimq_, d2eimr_, d2eims_, d2eimt_, d2eimu_, d2eimv_, d2eimw_, d2eimx_, d2eimy_
    automated match to d1occm_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eimz_

PDB Entry: 2eim (more details), 2.6 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (Z:) Cytochrome c oxidase polypeptide VIII-heart

SCOPe Domain Sequences for d2eimz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eimz_ f.23.7.1 (Z:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

SCOPe Domain Coordinates for d2eimz_:

Click to download the PDB-style file with coordinates for d2eimz_.
(The format of our PDB-style files is described here.)

Timeline for d2eimz_: