Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) automatically mapped to Pfam PF02285 |
Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins) |
Protein automated matches [190273] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187065] (16 PDB entries) |
Domain d2eimz_: 2eim Z: [132250] Other proteins in same PDB: d2eima_, d2eimb1, d2eimb2, d2eimc_, d2eimd_, d2eime_, d2eimf_, d2eimg_, d2eimh_, d2eimi_, d2eimj_, d2eimk_, d2eiml_, d2eimn_, d2eimo1, d2eimo2, d2eimp_, d2eimq_, d2eimr_, d2eims_, d2eimt_, d2eimu_, d2eimv_, d2eimw_, d2eimx_, d2eimy_ automated match to d1occm_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eim (more details), 2.6 Å
SCOPe Domain Sequences for d2eimz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eimz_ f.23.7.1 (Z:) automated matches {Cow (Bos taurus) [TaxId: 9913]} itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
Timeline for d2eimz_:
View in 3D Domains from other chains: (mouse over for more information) d2eima_, d2eimb1, d2eimb2, d2eimc_, d2eimd_, d2eime_, d2eimf_, d2eimg_, d2eimh_, d2eimi_, d2eimj_, d2eimk_, d2eiml_, d2eimm_, d2eimn_, d2eimo1, d2eimo2, d2eimp_, d2eimq_, d2eimr_, d2eims_, d2eimt_, d2eimu_, d2eimv_, d2eimw_, d2eimx_, d2eimy_ |