![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) ![]() |
![]() | Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81412] (24 PDB entries) |
![]() | Domain d2eimv_: 2eim V: [132246] Other proteins in same PDB: d2eima_, d2eimb1, d2eimb2, d2eimc_, d2eimd_, d2eime_, d2eimf_, d2eimg_, d2eimh_, d2eimj_, d2eimk_, d2eiml_, d2eimm_, d2eimn_, d2eimo1, d2eimo2, d2eimp_, d2eimq_, d2eimr_, d2eims_, d2eimt_, d2eimu_, d2eimw_, d2eimx_, d2eimy_, d2eimz_ automated match to d1occi_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eim (more details), 2.6 Å
SCOPe Domain Sequences for d2eimv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eimv_ f.23.3.1 (V:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]} stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf eemrkagifqsak
Timeline for d2eimv_:
![]() Domains from other chains: (mouse over for more information) d2eima_, d2eimb1, d2eimb2, d2eimc_, d2eimd_, d2eime_, d2eimf_, d2eimg_, d2eimh_, d2eimi_, d2eimj_, d2eimk_, d2eiml_, d2eimm_, d2eimn_, d2eimo1, d2eimo2, d2eimp_, d2eimq_, d2eimr_, d2eims_, d2eimt_, d2eimu_, d2eimw_, d2eimx_, d2eimy_, d2eimz_ |