![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
![]() | Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) ![]() |
![]() | Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
![]() | Protein automated matches [190271] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187063] (25 PDB entries) |
![]() | Domain d2eimu_: 2eim U: [132245] Other proteins in same PDB: d2eima_, d2eimb1, d2eimb2, d2eimc_, d2eimd_, d2eime_, d2eimf_, d2eimg_, d2eimi_, d2eimj_, d2eimk_, d2eiml_, d2eimm_, d2eimn_, d2eimo1, d2eimo2, d2eimp_, d2eimq_, d2eimr_, d2eims_, d2eimt_, d2eimv_, d2eimw_, d2eimx_, d2eimy_, d2eimz_ automated match to d1ocrh_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eim (more details), 2.6 Å
SCOPe Domain Sequences for d2eimu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eimu_ a.51.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]} kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi swvstwddrraegtfpgki
Timeline for d2eimu_:
![]() Domains from other chains: (mouse over for more information) d2eima_, d2eimb1, d2eimb2, d2eimc_, d2eimd_, d2eime_, d2eimf_, d2eimg_, d2eimh_, d2eimi_, d2eimj_, d2eimk_, d2eiml_, d2eimm_, d2eimn_, d2eimo1, d2eimo2, d2eimp_, d2eimq_, d2eimr_, d2eims_, d2eimt_, d2eimv_, d2eimw_, d2eimx_, d2eimy_, d2eimz_ |