SCOP 1.75: Domain d2eimu1: 2eim U:7-85

Lineage for d2eimu1 (2eim U:7-85)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family)

5. Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)

6. Protein Cytochrome c oxidase subunit h [47696] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47697] (14 PDB entries)

8. Domain d2eimu1: 2eim U:7-85 [132245]
   Other proteins in same PDB: d2eima1, d2eimb1, d2eimb2, d2eimc1, d2eimd1, d2eime1, d2eimf1, d2eimg1, d2eimi1, d2eimj1, d2eimk1, d2eiml1, d2eimm1, d2eimn1, d2eimo1, d2eimo2, d2eimp1, d2eimq1, d2eimr1, d2eims1, d2eimt1, d2eimv1, d2eimw1, d2eimx1, d2eimy1, d2eimz1
   automatically matched to d1ocrh_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eimu1

PDB Entry: 2eim, 2.6 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state

PDB Compounds: (U:) Cytochrome c oxidase subunit VIb isoform 1

SCOP Domain Sequences for d2eimu1:

Sequence; same for both SEQRES and ATOM records:

>d2eimu1 a.51.1.1 (U:7-85) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

Timeline for d2eimu1:

• d2eimu1 first appeared in SCOP 1.73
  
• d2eimu1 is called d2eimu_ in SCOPe 2.01
  
• d2eimu1 appears in the current release, SCOPe 2.08, called d2eimu_