Lineage for d2eimu1 (2eim U:7-85)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642471Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 642472Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 642473Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)
  6. 642474Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 642475Species Cow (Bos taurus) [TaxId:9913] [47697] (14 PDB entries)
  8. 642495Domain d2eimu1: 2eim U:7-85 [132245]
    Other proteins in same PDB: d2eima1, d2eimb1, d2eimb2, d2eimc1, d2eimd1, d2eime1, d2eimf1, d2eimg1, d2eimi1, d2eimj1, d2eimk1, d2eiml1, d2eimm1, d2eimn1, d2eimo1, d2eimo2, d2eimp1, d2eimq1, d2eimr1, d2eims1, d2eimt1, d2eimv1, d2eimw1, d2eimx1, d2eimy1, d2eimz1
    automatically matched to d1ocrh_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eimu1

PDB Entry: 2eim (more details), 2.6 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (U:) Cytochrome c oxidase subunit VIb isoform 1

SCOP Domain Sequences for d2eimu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eimu1 a.51.1.1 (U:7-85) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOP Domain Coordinates for d2eimu1:

Click to download the PDB-style file with coordinates for d2eimu1.
(The format of our PDB-style files is described here.)

Timeline for d2eimu1: