Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) |
Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (1 protein) |
Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species) probably responsible for the dimerization of the mitochondrial cytochrome c oxidase |
Species Cow (Bos taurus) [TaxId:9913] [81408] (14 PDB entries) |
Domain d2eimt1: 2eim T:1-84 [132244] Other proteins in same PDB: d2eima1, d2eimb1, d2eimb2, d2eimc1, d2eimd1, d2eime1, d2eimf1, d2eimh1, d2eimi1, d2eimj1, d2eimk1, d2eiml1, d2eimm1, d2eimn1, d2eimo1, d2eimo2, d2eimp1, d2eimq1, d2eimr1, d2eims1, d2eimu1, d2eimv1, d2eimw1, d2eimx1, d2eimy1, d2eimz1 automatically matched to d1occg_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eim (more details), 2.6 Å
SCOP Domain Sequences for d2eimt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eimt1 f.23.2.1 (T:1-84) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]} asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf swgdgnhtffhnprvnplptgyek
Timeline for d2eimt1:
View in 3D Domains from other chains: (mouse over for more information) d2eima1, d2eimb1, d2eimb2, d2eimc1, d2eimd1, d2eime1, d2eimf1, d2eimg1, d2eimh1, d2eimi1, d2eimj1, d2eimk1, d2eiml1, d2eimm1, d2eimn1, d2eimo1, d2eimo2, d2eimp1, d2eimq1, d2eimr1, d2eims1, d2eimu1, d2eimv1, d2eimw1, d2eimx1, d2eimy1, d2eimz1 |