Lineage for d2eims1 (2eim S:1-98)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 750855Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 750979Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
    membrane-anchored rubredoxin-like domain
  6. 750980Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 750981Species Cow (Bos taurus) [TaxId:9913] [57820] (14 PDB entries)
  8. 751001Domain d2eims1: 2eim S:1-98 [132243]
    Other proteins in same PDB: d2eima1, d2eimb1, d2eimb2, d2eimc1, d2eimd1, d2eime1, d2eimg1, d2eimh1, d2eimi1, d2eimj1, d2eimk1, d2eiml1, d2eimm1, d2eimn1, d2eimo1, d2eimo2, d2eimp1, d2eimq1, d2eimr1, d2eimt1, d2eimu1, d2eimv1, d2eimw1, d2eimx1, d2eimy1, d2eimz1
    automatically matched to d1occf_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eims1

PDB Entry: 2eim (more details), 2.6 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (S:) Cytochrome c oxidase polypeptide Vb

SCOP Domain Sequences for d2eims1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eims1 g.41.5.3 (S:1-98) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOP Domain Coordinates for d2eims1:

Click to download the PDB-style file with coordinates for d2eims1.
(The format of our PDB-style files is described here.)

Timeline for d2eims1: