Lineage for d2eimq1 (2eim Q:4-147)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 745534Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
  5. 745535Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (1 protein)
  6. 745536Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 745537Species Cow (Bos taurus) [TaxId:9913] [81403] (14 PDB entries)
  8. 745557Domain d2eimq1: 2eim Q:4-147 [132241]
    Other proteins in same PDB: d2eima1, d2eimb1, d2eimb2, d2eimc1, d2eime1, d2eimf1, d2eimg1, d2eimh1, d2eimi1, d2eimj1, d2eimk1, d2eiml1, d2eimm1, d2eimn1, d2eimo1, d2eimo2, d2eimp1, d2eimr1, d2eims1, d2eimt1, d2eimu1, d2eimv1, d2eimw1, d2eimx1, d2eimy1, d2eimz1
    automatically matched to d1occd_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eimq1

PDB Entry: 2eim (more details), 2.6 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (Q:) Cytochrome c oxidase subunit 4 isoform 1

SCOP Domain Sequences for d2eimq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eimq1 f.23.1.1 (Q:4-147) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

SCOP Domain Coordinates for d2eimq1:

Click to download the PDB-style file with coordinates for d2eimq1.
(The format of our PDB-style files is described here.)

Timeline for d2eimq1: