Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) |
Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (1 protein) |
Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
Species Cow (Bos taurus) [TaxId:9913] [81403] (14 PDB entries) |
Domain d2eimq1: 2eim Q:4-147 [132241] Other proteins in same PDB: d2eima1, d2eimb1, d2eimb2, d2eimc1, d2eime1, d2eimf1, d2eimg1, d2eimh1, d2eimi1, d2eimj1, d2eimk1, d2eiml1, d2eimm1, d2eimn1, d2eimo1, d2eimo2, d2eimp1, d2eimr1, d2eims1, d2eimt1, d2eimu1, d2eimv1, d2eimw1, d2eimx1, d2eimy1, d2eimz1 automatically matched to d1occd_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eim (more details), 2.6 Å
SCOP Domain Sequences for d2eimq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eimq1 f.23.1.1 (Q:4-147) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]} svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm ldmkvapiqgfsakwdydknewkk
Timeline for d2eimq1:
View in 3D Domains from other chains: (mouse over for more information) d2eima1, d2eimb1, d2eimb2, d2eimc1, d2eimd1, d2eime1, d2eimf1, d2eimg1, d2eimh1, d2eimi1, d2eimj1, d2eimk1, d2eiml1, d2eimm1, d2eimn1, d2eimo1, d2eimo2, d2eimp1, d2eimr1, d2eims1, d2eimt1, d2eimu1, d2eimv1, d2eimw1, d2eimx1, d2eimy1, d2eimz1 |