Lineage for d2eimo2 (2eim O:1-90)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629297Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2629435Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2629436Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 2629488Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 2629489Species Cow (Bos taurus) [TaxId:9913] [81454] (45 PDB entries)
  8. 2629556Domain d2eimo2: 2eim O:1-90 [132239]
    Other proteins in same PDB: d2eima_, d2eimb1, d2eimc_, d2eimd_, d2eime_, d2eimf_, d2eimg_, d2eimh_, d2eimi_, d2eimj_, d2eimk_, d2eiml_, d2eimm_, d2eimn_, d2eimo1, d2eimp_, d2eimq_, d2eimr_, d2eims_, d2eimt_, d2eimu_, d2eimv_, d2eimw_, d2eimx_, d2eimy_, d2eimz_
    automated match to d1v54b2
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eimo2

PDB Entry: 2eim (more details), 2.6 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2eimo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eimo2 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d2eimo2:

Click to download the PDB-style file with coordinates for d2eimo2.
(The format of our PDB-style files is described here.)

Timeline for d2eimo2: