Lineage for d2eimm1 (2eim M:1-43)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887321Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) (S)
  5. 887322Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (1 protein)
  6. 887323Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 887324Species Cow (Bos taurus) [TaxId:9913] [81428] (14 PDB entries)
  8. 887343Domain d2eimm1: 2eim M:1-43 [132236]
    Other proteins in same PDB: d2eima1, d2eimb1, d2eimb2, d2eimc1, d2eimd1, d2eime1, d2eimf1, d2eimg1, d2eimh1, d2eimi1, d2eimj1, d2eimk1, d2eiml1, d2eimn1, d2eimo1, d2eimo2, d2eimp1, d2eimq1, d2eimr1, d2eims1, d2eimt1, d2eimu1, d2eimv1, d2eimw1, d2eimx1, d2eimy1
    automatically matched to d1occm_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eimm1

PDB Entry: 2eim (more details), 2.6 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (M:) Cytochrome c oxidase polypeptide VIII-heart

SCOP Domain Sequences for d2eimm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eimm1 f.23.7.1 (M:1-43) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

SCOP Domain Coordinates for d2eimm1:

Click to download the PDB-style file with coordinates for d2eimm1.
(The format of our PDB-style files is described here.)

Timeline for d2eimm1: