Lineage for d2eimj1 (2eim J:1-58)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 745630Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) (S)
  5. 745631Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (1 protein)
  6. 745632Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 745633Species Cow (Bos taurus) [TaxId:9913] [81416] (14 PDB entries)
  8. 745652Domain d2eimj1: 2eim J:1-58 [132233]
    Other proteins in same PDB: d2eima1, d2eimb1, d2eimb2, d2eimc1, d2eimd1, d2eime1, d2eimf1, d2eimg1, d2eimh1, d2eimi1, d2eimk1, d2eiml1, d2eimm1, d2eimn1, d2eimo1, d2eimo2, d2eimp1, d2eimq1, d2eimr1, d2eims1, d2eimt1, d2eimu1, d2eimv1, d2eimx1, d2eimy1, d2eimz1
    automatically matched to d1ocrj_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eimj1

PDB Entry: 2eim (more details), 2.6 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (J:) Cytochrome c oxidase polypeptide VIIa-heart

SCOP Domain Sequences for d2eimj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eimj1 f.23.4.1 (J:1-58) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk

SCOP Domain Coordinates for d2eimj1:

Click to download the PDB-style file with coordinates for d2eimj1.
(The format of our PDB-style files is described here.)

Timeline for d2eimj1: