Lineage for d2eimh_ (2eim H:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737085Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 1737086Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 1737087Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 1737109Protein automated matches [190271] (1 species)
    not a true protein
  7. 1737110Species Cow (Bos taurus) [TaxId:9913] [187063] (18 PDB entries)
  8. 1737142Domain d2eimh_: 2eim H: [132231]
    Other proteins in same PDB: d2eima_, d2eimb1, d2eimb2, d2eimc_, d2eimd_, d2eime_, d2eimf_, d2eimg_, d2eimi_, d2eimj_, d2eimk_, d2eiml_, d2eimm_, d2eimn_, d2eimo1, d2eimo2, d2eimp_, d2eimq_, d2eimr_, d2eims_, d2eimt_, d2eimv_, d2eimw_, d2eimx_, d2eimy_, d2eimz_
    automated match to d1ocrh_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eimh_

PDB Entry: 2eim (more details), 2.6 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (H:) Cytochrome c oxidase subunit VIb isoform 1

SCOPe Domain Sequences for d2eimh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eimh_ a.51.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d2eimh_:

Click to download the PDB-style file with coordinates for d2eimh_.
(The format of our PDB-style files is described here.)

Timeline for d2eimh_: