SCOP 1.73: Domain d2eimg1: 2eim G:1-84

Lineage for d2eimg1 (2eim G:1-84)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family)

5. Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
   probably responsible for the dimerization of the mitochondrial cytochrome c oxidase

7. Species Cow (Bos taurus) [TaxId:9913] [81408] (14 PDB entries)

8. Domain d2eimg1: 2eim G:1-84 [132230]
   Other proteins in same PDB: d2eima1, d2eimb1, d2eimb2, d2eimc1, d2eimd1, d2eime1, d2eimf1, d2eimh1, d2eimi1, d2eimj1, d2eimk1, d2eiml1, d2eimm1, d2eimn1, d2eimo1, d2eimo2, d2eimp1, d2eimq1, d2eimr1, d2eims1, d2eimu1, d2eimv1, d2eimw1, d2eimx1, d2eimy1, d2eimz1
   automatically matched to d1occg_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eimg1

PDB Entry: 2eim, 2.6 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state

PDB Compounds: (G:) Cytochrome c oxidase polypeptide VIa-heart

SCOP Domain Sequences for d2eimg1:

Sequence; same for both SEQRES and ATOM records:

>d2eimg1 f.23.2.1 (G:1-84) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

Timeline for d2eimg1:

• d2eimg1 is new in SCOP 1.73
  
• d2eimg1 appears in SCOP 1.75
  
• d2eimg1 appears in the current release, SCOPe 2.08, called d2eimg_