SCOP 1.73: Domain d2eimf1: 2eim F:1-98

Lineage for d2eimf1 (2eim F:1-98)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (3 families)

5. Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
   membrane-anchored rubredoxin-like domain

6. Protein Cytochrome c oxidase Subunit F [57819] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57820] (14 PDB entries)

8. Domain d2eimf1: 2eim F:1-98 [132229]
   Other proteins in same PDB: d2eima1, d2eimb1, d2eimb2, d2eimc1, d2eimd1, d2eime1, d2eimg1, d2eimh1, d2eimi1, d2eimj1, d2eimk1, d2eiml1, d2eimm1, d2eimn1, d2eimo1, d2eimo2, d2eimp1, d2eimq1, d2eimr1, d2eimt1, d2eimu1, d2eimv1, d2eimw1, d2eimx1, d2eimy1, d2eimz1
   automatically matched to d1occf_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eimf1

PDB Entry: 2eim, 2.6 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state

PDB Compounds: (F:) Cytochrome c oxidase polypeptide Vb

SCOP Domain Sequences for d2eimf1:

Sequence; same for both SEQRES and ATOM records:

>d2eimf1 g.41.5.3 (F:1-98) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

Timeline for d2eimf1:

• d2eimf1 is new in SCOP 1.73
  
• d2eimf1 appears in SCOP 1.75
  
• d2eimf1 appears in the current release, SCOPe 2.07, called d2eimf_