Lineage for d2eimd_ (2eim D:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456646Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1456647Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
    automatically mapped to Pfam PF02936
  5. 1456648Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)
  6. 1456666Protein automated matches [190270] (1 species)
    not a true protein
  7. 1456667Species Cow (Bos taurus) [TaxId:9913] [187062] (17 PDB entries)
  8. 1456697Domain d2eimd_: 2eim D: [132227]
    Other proteins in same PDB: d2eima_, d2eimb1, d2eimb2, d2eimc_, d2eime_, d2eimf_, d2eimg_, d2eimh_, d2eimi_, d2eimj_, d2eimk_, d2eiml_, d2eimm_, d2eimn_, d2eimo1, d2eimo2, d2eimp_, d2eimr_, d2eims_, d2eimt_, d2eimu_, d2eimv_, d2eimw_, d2eimx_, d2eimy_, d2eimz_
    automated match to d1occd_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eimd_

PDB Entry: 2eim (more details), 2.6 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (D:) Cytochrome c oxidase subunit 4 isoform 1

SCOPe Domain Sequences for d2eimd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eimd_ f.23.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

SCOPe Domain Coordinates for d2eimd_:

Click to download the PDB-style file with coordinates for d2eimd_.
(The format of our PDB-style files is described here.)

Timeline for d2eimd_: