Lineage for d2eimc_ (2eim C:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1238962Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 1238963Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
  5. 1238964Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 1238977Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 1238978Species Cow (Bos taurus) [TaxId:9913] [81444] (24 PDB entries)
  8. 1239017Domain d2eimc_: 2eim C: [132226]
    Other proteins in same PDB: d2eima_, d2eimb1, d2eimb2, d2eimd_, d2eime_, d2eimf_, d2eimg_, d2eimh_, d2eimi_, d2eimj_, d2eimk_, d2eiml_, d2eimm_, d2eimn_, d2eimo1, d2eimo2, d2eimq_, d2eimr_, d2eims_, d2eimt_, d2eimu_, d2eimv_, d2eimw_, d2eimx_, d2eimy_, d2eimz_
    automated match to d1occc_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eimc_

PDB Entry: 2eim (more details), 2.6 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d2eimc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eimc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d2eimc_:

Click to download the PDB-style file with coordinates for d2eimc_.
(The format of our PDB-style files is described here.)

Timeline for d2eimc_: