Lineage for d2eimb2 (2eim B:1-90)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886795Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 886817Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 886818Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 886844Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 886845Species Cow (Bos taurus) [TaxId:9913] [81454] (14 PDB entries)
  8. 886864Domain d2eimb2: 2eim B:1-90 [132225]
    Other proteins in same PDB: d2eima1, d2eimb1, d2eimc1, d2eimd1, d2eime1, d2eimf1, d2eimg1, d2eimh1, d2eimi1, d2eimj1, d2eimk1, d2eiml1, d2eimm1, d2eimn1, d2eimo1, d2eimp1, d2eimq1, d2eimr1, d2eims1, d2eimt1, d2eimu1, d2eimv1, d2eimw1, d2eimx1, d2eimy1, d2eimz1
    automatically matched to d1occb2
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eimb2

PDB Entry: 2eim (more details), 2.6 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOP Domain Sequences for d2eimb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eimb2 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOP Domain Coordinates for d2eimb2:

Click to download the PDB-style file with coordinates for d2eimb2.
(The format of our PDB-style files is described here.)

Timeline for d2eimb2: