Lineage for d2eimb1 (2eim B:91-227)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660834Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 660835Protein Cytochrome c oxidase [49544] (4 species)
  7. 660836Species Cow (Bos taurus) [TaxId:9913] [49545] (14 PDB entries)
  8. 660855Domain d2eimb1: 2eim B:91-227 [132224]
    Other proteins in same PDB: d2eima1, d2eimb2, d2eimc1, d2eimd1, d2eime1, d2eimf1, d2eimg1, d2eimh1, d2eimi1, d2eimj1, d2eimk1, d2eiml1, d2eimm1, d2eimn1, d2eimo2, d2eimp1, d2eimq1, d2eimr1, d2eims1, d2eimt1, d2eimu1, d2eimv1, d2eimw1, d2eimx1, d2eimy1, d2eimz1
    automatically matched to d1occb1
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eimb1

PDB Entry: 2eim (more details), 2.6 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOP Domain Sequences for d2eimb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eimb1 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOP Domain Coordinates for d2eimb1:

Click to download the PDB-style file with coordinates for d2eimb1.
(The format of our PDB-style files is described here.)

Timeline for d2eimb1: