SCOP 1.73: Domain d2eily1: 2eil Y:2-47

Lineage for d2eily1 (2eil Y:2-47)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family)

5. Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81424] (14 PDB entries)

8. Domain d2eily1: 2eil Y:2-47 [132221]
   Other proteins in same PDB: d2eila1, d2eilb1, d2eilb2, d2eilc1, d2eild1, d2eile1, d2eilf1, d2eilg1, d2eilh1, d2eili1, d2eilj1, d2eilk1, d2eilm1, d2eiln1, d2eilo1, d2eilo2, d2eilp1, d2eilq1, d2eilr1, d2eils1, d2eilt1, d2eilu1, d2eilv1, d2eilw1, d2eilx1, d2eilz1
   automatically matched to d1occl_
   complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eily1

PDB Entry: 2eil, 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state

PDB Compounds: (Y:) Cytochrome c oxidase polypeptide VIIc

SCOP Domain Sequences for d2eily1:

Sequence; same for both SEQRES and ATOM records:

>d2eily1 f.23.6.1 (Y:2-47) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

Timeline for d2eily1:

• d2eily1 is new in SCOP 1.73
  
• d2eily1 appears in SCOP 1.75
  
• d2eily1 appears in the current release, SCOPe 2.08, called d2eily_