Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) automatically mapped to Pfam PF05392 |
Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins) |
Protein automated matches [190272] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187064] (26 PDB entries) |
Domain d2eilx_: 2eil X: [132220] Other proteins in same PDB: d2eila_, d2eilb1, d2eilb2, d2eilc_, d2eild_, d2eile_, d2eilf_, d2eilg_, d2eilh_, d2eili_, d2eilj_, d2eill_, d2eilm_, d2eiln_, d2eilo1, d2eilo2, d2eilp_, d2eilq_, d2eilr_, d2eils_, d2eilt_, d2eilu_, d2eilv_, d2eilw_, d2eily_, d2eilz_ automated match to d1occk_ complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eil (more details), 2.1 Å
SCOPe Domain Sequences for d2eilx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eilx_ f.23.5.1 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]} apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
Timeline for d2eilx_:
View in 3D Domains from other chains: (mouse over for more information) d2eila_, d2eilb1, d2eilb2, d2eilc_, d2eild_, d2eile_, d2eilf_, d2eilg_, d2eilh_, d2eili_, d2eilj_, d2eilk_, d2eill_, d2eilm_, d2eiln_, d2eilo1, d2eilo2, d2eilp_, d2eilq_, d2eilr_, d2eils_, d2eilt_, d2eilu_, d2eilv_, d2eilw_, d2eily_, d2eilz_ |