![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) ![]() automatically mapped to Pfam PF02238 |
![]() | Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 proteins) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81416] (36 PDB entries) |
![]() | Domain d2eilw_: 2eil W: [132219] Other proteins in same PDB: d2eila_, d2eilb1, d2eilb2, d2eilc_, d2eild_, d2eile_, d2eilf_, d2eilg_, d2eilh_, d2eili_, d2eilk_, d2eill_, d2eilm_, d2eiln_, d2eilo1, d2eilo2, d2eilp_, d2eilq_, d2eilr_, d2eils_, d2eilt_, d2eilu_, d2eilv_, d2eilx_, d2eily_, d2eilz_ automated match to d1ocrj_ complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eil (more details), 2.1 Å
SCOPe Domain Sequences for d2eilw_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eilw_ f.23.4.1 (W:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]} fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk
Timeline for d2eilw_:
![]() Domains from other chains: (mouse over for more information) d2eila_, d2eilb1, d2eilb2, d2eilc_, d2eild_, d2eile_, d2eilf_, d2eilg_, d2eilh_, d2eili_, d2eilj_, d2eilk_, d2eill_, d2eilm_, d2eiln_, d2eilo1, d2eilo2, d2eilp_, d2eilq_, d2eilr_, d2eils_, d2eilt_, d2eilu_, d2eilv_, d2eilx_, d2eily_, d2eilz_ |