SCOP 1.73: Domain d2eilo2: 2eil O:1-90

Lineage for d2eilo2 (2eil O:1-90)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (3 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (14 PDB entries)

8. Domain d2eilo2: 2eil O:1-90 [132211]
   Other proteins in same PDB: d2eila1, d2eilb1, d2eilc1, d2eild1, d2eile1, d2eilf1, d2eilg1, d2eilh1, d2eili1, d2eilj1, d2eilk1, d2eill1, d2eilm1, d2eiln1, d2eilo1, d2eilp1, d2eilq1, d2eilr1, d2eils1, d2eilt1, d2eilu1, d2eilv1, d2eilw1, d2eilx1, d2eily1, d2eilz1
   automatically matched to d1occb2
   complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eilo2

PDB Entry: 2eil, 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state

PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOP Domain Sequences for d2eilo2:

Sequence; same for both SEQRES and ATOM records:

>d2eilo2 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

Timeline for d2eilo2:

• d2eilo2 is new in SCOP 1.73
  
• d2eilo2 appears in SCOP 1.75
  
• d2eilo2 appears in the current release, SCOPe 2.08