Lineage for d2eiln1 (2eil N:1-514)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746107Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 746108Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 746109Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (4 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 746129Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species)
  7. 746130Species Cow (Bos taurus) [TaxId:9913] [81432] (14 PDB entries)
  8. 746140Domain d2eiln1: 2eil N:1-514 [132209]
    Other proteins in same PDB: d2eilb1, d2eilb2, d2eilc1, d2eild1, d2eile1, d2eilf1, d2eilg1, d2eilh1, d2eili1, d2eilj1, d2eilk1, d2eill1, d2eilm1, d2eilo1, d2eilo2, d2eilp1, d2eilq1, d2eilr1, d2eils1, d2eilt1, d2eilu1, d2eilv1, d2eilw1, d2eilx1, d2eily1, d2eilz1
    automatically matched to d1occa_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eiln1

PDB Entry: 2eil (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (N:) Cytochrome c oxidase subunit 1

SCOP Domain Sequences for d2eiln1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eiln1 f.24.1.1 (N:1-514) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

SCOP Domain Coordinates for d2eiln1:

Click to download the PDB-style file with coordinates for d2eiln1.
(The format of our PDB-style files is described here.)

Timeline for d2eiln1: