Lineage for d2eilk_ (2eil K:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456646Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1456857Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
    automatically mapped to Pfam PF05392
  5. 1456858Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 1456876Protein automated matches [190272] (1 species)
    not a true protein
  7. 1456877Species Cow (Bos taurus) [TaxId:9913] [187064] (16 PDB entries)
  8. 1456894Domain d2eilk_: 2eil K: [132206]
    Other proteins in same PDB: d2eila_, d2eilb1, d2eilb2, d2eilc_, d2eild_, d2eile_, d2eilf_, d2eilg_, d2eilh_, d2eili_, d2eilj_, d2eill_, d2eilm_, d2eiln_, d2eilo1, d2eilo2, d2eilp_, d2eilq_, d2eilr_, d2eils_, d2eilt_, d2eilu_, d2eilv_, d2eilw_, d2eily_, d2eilz_
    automated match to d1occk_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eilk_

PDB Entry: 2eil (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (K:) Cytochrome c oxidase polypeptide VIIb

SCOPe Domain Sequences for d2eilk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eilk_ f.23.5.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d2eilk_:

Click to download the PDB-style file with coordinates for d2eilk_.
(The format of our PDB-style files is described here.)

Timeline for d2eilk_: