Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) |
Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein) |
Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
Species Cow (Bos taurus) [TaxId:9913] [81412] (14 PDB entries) |
Domain d2eili1: 2eil I:1-73 [132204] Other proteins in same PDB: d2eila1, d2eilb1, d2eilb2, d2eilc1, d2eild1, d2eile1, d2eilf1, d2eilg1, d2eilh1, d2eilj1, d2eilk1, d2eill1, d2eilm1, d2eiln1, d2eilo1, d2eilo2, d2eilp1, d2eilq1, d2eilr1, d2eils1, d2eilt1, d2eilu1, d2eilw1, d2eilx1, d2eily1, d2eilz1 automatically matched to d1occi_ complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eil (more details), 2.1 Å
SCOP Domain Sequences for d2eili1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eili1 f.23.3.1 (I:1-73) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]} stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf eemrkagifqsak
Timeline for d2eili1:
View in 3D Domains from other chains: (mouse over for more information) d2eila1, d2eilb1, d2eilb2, d2eilc1, d2eild1, d2eile1, d2eilf1, d2eilg1, d2eilh1, d2eilj1, d2eilk1, d2eill1, d2eilm1, d2eiln1, d2eilo1, d2eilo2, d2eilp1, d2eilq1, d2eilr1, d2eils1, d2eilt1, d2eilu1, d2eilv1, d2eilw1, d2eilx1, d2eily1, d2eilz1 |