SCOPe 2.03: Domain d2eilh_: 2eil H:

Lineage for d2eilh_ (2eil H:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family)

5. Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)

6. Protein automated matches [190271] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187063] (17 PDB entries)

8. Domain d2eilh_: 2eil H: [132203]
   Other proteins in same PDB: d2eila_, d2eilb1, d2eilb2, d2eilc_, d2eild_, d2eile_, d2eilf_, d2eilg_, d2eili_, d2eilj_, d2eilk_, d2eill_, d2eilm_, d2eiln_, d2eilo1, d2eilo2, d2eilp_, d2eilq_, d2eilr_, d2eils_, d2eilt_, d2eilv_, d2eilw_, d2eilx_, d2eily_, d2eilz_
   automated match to d1ocrh_
   complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eilh_

PDB Entry: 2eil, 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state

PDB Compounds: (H:) Cytochrome c oxidase subunit VIb isoform 1

SCOPe Domain Sequences for d2eilh_:

Sequence; same for both SEQRES and ATOM records:

>d2eilh_ a.51.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

Timeline for d2eilh_:

• d2eilh_ first appeared in SCOP 1.73, called d2eilh1
  
• d2eilh_ appears in SCOPe 2.02
  
• d2eilh_ appears in SCOPe 2.04
  
• d2eilh_ appears in the current release, SCOPe 2.08