Lineage for d2eilh1 (2eil H:7-85)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770504Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 770505Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 770506Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)
  6. 770507Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 770508Species Cow (Bos taurus) [TaxId:9913] [47697] (14 PDB entries)
  8. 770517Domain d2eilh1: 2eil H:7-85 [132203]
    Other proteins in same PDB: d2eila1, d2eilb1, d2eilb2, d2eilc1, d2eild1, d2eile1, d2eilf1, d2eilg1, d2eili1, d2eilj1, d2eilk1, d2eill1, d2eilm1, d2eiln1, d2eilo1, d2eilo2, d2eilp1, d2eilq1, d2eilr1, d2eils1, d2eilt1, d2eilv1, d2eilw1, d2eilx1, d2eily1, d2eilz1
    automatically matched to d1ocrh_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eilh1

PDB Entry: 2eil (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (H:) Cytochrome c oxidase subunit VIb isoform 1

SCOP Domain Sequences for d2eilh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eilh1 a.51.1.1 (H:7-85) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOP Domain Coordinates for d2eilh1:

Click to download the PDB-style file with coordinates for d2eilh1.
(The format of our PDB-style files is described here.)

Timeline for d2eilh1: