Lineage for d2eilf1 (2eil F:1-98)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 893109Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 893235Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
    membrane-anchored rubredoxin-like domain
  6. 893236Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 893237Species Cow (Bos taurus) [TaxId:9913] [57820] (14 PDB entries)
  8. 893246Domain d2eilf1: 2eil F:1-98 [132201]
    Other proteins in same PDB: d2eila1, d2eilb1, d2eilb2, d2eilc1, d2eild1, d2eile1, d2eilg1, d2eilh1, d2eili1, d2eilj1, d2eilk1, d2eill1, d2eilm1, d2eiln1, d2eilo1, d2eilo2, d2eilp1, d2eilq1, d2eilr1, d2eilt1, d2eilu1, d2eilv1, d2eilw1, d2eilx1, d2eily1, d2eilz1
    automatically matched to d1occf_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eilf1

PDB Entry: 2eil (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (F:) Cytochrome c oxidase polypeptide Vb

SCOP Domain Sequences for d2eilf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eilf1 g.41.5.3 (F:1-98) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOP Domain Coordinates for d2eilf1:

Click to download the PDB-style file with coordinates for d2eilf1.
(The format of our PDB-style files is described here.)

Timeline for d2eilf1: