Lineage for d2eile_ (2eil E:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 922772Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 922773Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 922774Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 922775Species Cow (Bos taurus) [TaxId:9913] [48482] (22 PDB entries)
  8. 922796Domain d2eile_: 2eil E: [132200]
    Other proteins in same PDB: d2eila_, d2eilb1, d2eilb2, d2eilc_, d2eild_, d2eilf_, d2eilg_, d2eilh_, d2eili_, d2eilj_, d2eilk_, d2eill_, d2eilm_, d2eiln_, d2eilo1, d2eilo2, d2eilp_, d2eilq_, d2eils_, d2eilt_, d2eilu_, d2eilv_, d2eilw_, d2eilx_, d2eily_, d2eilz_
    automated match to d1occe_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eile_

PDB Entry: 2eil (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (E:) Cytochrome c oxidase polypeptide Va

SCOPe Domain Sequences for d2eile_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eile_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d2eile_:

Click to download the PDB-style file with coordinates for d2eile_.
(The format of our PDB-style files is described here.)

Timeline for d2eile_: