![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) ![]() |
![]() | Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein) |
![]() | Protein Cytochrome c oxidase subunit E [48481] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [48482] (14 PDB entries) |
![]() | Domain d2eile1: 2eil E:5-109 [132200] Other proteins in same PDB: d2eila1, d2eilb1, d2eilb2, d2eilc1, d2eild1, d2eilf1, d2eilg1, d2eilh1, d2eili1, d2eilj1, d2eilk1, d2eill1, d2eilm1, d2eiln1, d2eilo1, d2eilo2, d2eilp1, d2eilq1, d2eils1, d2eilt1, d2eilu1, d2eilv1, d2eilw1, d2eilx1, d2eily1, d2eilz1 automatically matched to d1occe_ complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eil (more details), 2.1 Å
SCOP Domain Sequences for d2eile1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eile1 a.118.11.1 (E:5-109) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
Timeline for d2eile1:
![]() Domains from other chains: (mouse over for more information) d2eila1, d2eilb1, d2eilb2, d2eilc1, d2eild1, d2eilf1, d2eilg1, d2eilh1, d2eili1, d2eilj1, d2eilk1, d2eill1, d2eilm1, d2eiln1, d2eilo1, d2eilo2, d2eilp1, d2eilq1, d2eilr1, d2eils1, d2eilt1, d2eilu1, d2eilv1, d2eilw1, d2eilx1, d2eily1, d2eilz1 |