Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) automatically mapped to Pfam PF00510 |
Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81444] (37 PDB entries) |
Domain d2eilc_: 2eil C: [132198] Other proteins in same PDB: d2eila_, d2eilb1, d2eilb2, d2eild_, d2eile_, d2eilf_, d2eilg_, d2eilh_, d2eili_, d2eilj_, d2eilk_, d2eill_, d2eilm_, d2eiln_, d2eilo1, d2eilo2, d2eilq_, d2eilr_, d2eils_, d2eilt_, d2eilu_, d2eilv_, d2eilw_, d2eilx_, d2eily_, d2eilz_ automated match to d1occc_ complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eil (more details), 2.1 Å
SCOPe Domain Sequences for d2eilc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eilc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw hfvdvvwlflyvsiywwgs
Timeline for d2eilc_:
View in 3D Domains from other chains: (mouse over for more information) d2eila_, d2eilb1, d2eilb2, d2eild_, d2eile_, d2eilf_, d2eilg_, d2eilh_, d2eili_, d2eilj_, d2eilk_, d2eill_, d2eilm_, d2eiln_, d2eilo1, d2eilo2, d2eilp_, d2eilq_, d2eilr_, d2eils_, d2eilt_, d2eilu_, d2eilv_, d2eilw_, d2eilx_, d2eily_, d2eilz_ |