Lineage for d2eilc1 (2eil C:3-261)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746159Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 746160Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
  5. 746161Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 746174Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 746175Species Cow (Bos taurus) [TaxId:9913] [81444] (14 PDB entries)
  8. 746184Domain d2eilc1: 2eil C:3-261 [132198]
    Other proteins in same PDB: d2eila1, d2eilb1, d2eilb2, d2eild1, d2eile1, d2eilf1, d2eilg1, d2eilh1, d2eili1, d2eilj1, d2eilk1, d2eill1, d2eilm1, d2eiln1, d2eilo1, d2eilo2, d2eilq1, d2eilr1, d2eils1, d2eilt1, d2eilu1, d2eilv1, d2eilw1, d2eilx1, d2eily1, d2eilz1
    automatically matched to d1v54c_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eilc1

PDB Entry: 2eil (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOP Domain Sequences for d2eilc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eilc1 f.25.1.1 (C:3-261) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOP Domain Coordinates for d2eilc1:

Click to download the PDB-style file with coordinates for d2eilc1.
(The format of our PDB-style files is described here.)

Timeline for d2eilc1: