Lineage for d2eilb2 (2eil B:1-90)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745255Fold f.17: Transmembrane helix hairpin [81334] (3 superfamilies)
    two antiparallel transmembrane helices
  4. 745277Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 745278Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 745298Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 745299Species Cow (Bos taurus) [TaxId:9913] [81454] (14 PDB entries)
  8. 745308Domain d2eilb2: 2eil B:1-90 [132197]
    Other proteins in same PDB: d2eila1, d2eilb1, d2eilc1, d2eild1, d2eile1, d2eilf1, d2eilg1, d2eilh1, d2eili1, d2eilj1, d2eilk1, d2eill1, d2eilm1, d2eiln1, d2eilo1, d2eilp1, d2eilq1, d2eilr1, d2eils1, d2eilt1, d2eilu1, d2eilv1, d2eilw1, d2eilx1, d2eily1, d2eilz1
    automatically matched to d1occb2
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eilb2

PDB Entry: 2eil (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOP Domain Sequences for d2eilb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eilb2 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOP Domain Coordinates for d2eilb2:

Click to download the PDB-style file with coordinates for d2eilb2.
(The format of our PDB-style files is described here.)

Timeline for d2eilb2: