Lineage for d2eilb2 (2eil B:1-90)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577253Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2577295Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 2577296Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 protein domains)
  6. 2577345Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 2577346Species Cow (Bos taurus) [TaxId:9913] [81454] (36 PDB entries)
  8. 2577371Domain d2eilb2: 2eil B:1-90 [132197]
    Other proteins in same PDB: d2eila_, d2eilb1, d2eilc_, d2eild_, d2eile_, d2eilf_, d2eilg_, d2eilh_, d2eili_, d2eilj_, d2eilk_, d2eill_, d2eilm_, d2eiln_, d2eilo1, d2eilp_, d2eilq_, d2eilr_, d2eils_, d2eilt_, d2eilu_, d2eilv_, d2eilw_, d2eilx_, d2eily_, d2eilz_
    automated match to d1v54b2
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eilb2

PDB Entry: 2eil (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2eilb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eilb2 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d2eilb2:

Click to download the PDB-style file with coordinates for d2eilb2.
(The format of our PDB-style files is described here.)

Timeline for d2eilb2: