Lineage for d2eiks_ (2eik S:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066160Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 1066318Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
    membrane-anchored rubredoxin-like domain
  6. 1066319Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 1066320Species Cow (Bos taurus) [TaxId:9913] [57820] (22 PDB entries)
  8. 1066346Domain d2eiks_: 2eik S: [132187]
    Other proteins in same PDB: d2eika_, d2eikb1, d2eikb2, d2eikc_, d2eikd_, d2eike_, d2eikg_, d2eikh_, d2eiki_, d2eikj_, d2eikk_, d2eikl_, d2eikm_, d2eikn_, d2eiko1, d2eiko2, d2eikp_, d2eikq_, d2eikr_, d2eikt_, d2eiku_, d2eikv_, d2eikw_, d2eikx_, d2eiky_, d2eikz_
    automated match to d1occf_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eiks_

PDB Entry: 2eik (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (S:) Cytochrome c oxidase polypeptide Vb

SCOPe Domain Sequences for d2eiks_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eiks_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOPe Domain Coordinates for d2eiks_:

Click to download the PDB-style file with coordinates for d2eiks_.
(The format of our PDB-style files is described here.)

Timeline for d2eiks_: