| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) ![]() automatically mapped to Pfam PF00510 |
| Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
| Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [81444] (52 PDB entries) |
| Domain d2eikp_: 2eik P: [132184] Other proteins in same PDB: d2eika_, d2eikb1, d2eikb2, d2eikd_, d2eike_, d2eikf_, d2eikg_, d2eikh_, d2eiki_, d2eikj_, d2eikk_, d2eikl_, d2eikm_, d2eikn_, d2eiko1, d2eiko2, d2eikq_, d2eikr_, d2eiks_, d2eikt_, d2eiku_, d2eikv_, d2eikw_, d2eikx_, d2eiky_, d2eikz_ automated match to d1occc_ complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eik (more details), 2.1 Å
SCOPe Domain Sequences for d2eikp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eikp_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs
Timeline for d2eikp_:
View in 3DDomains from other chains: (mouse over for more information) d2eika_, d2eikb1, d2eikb2, d2eikc_, d2eikd_, d2eike_, d2eikf_, d2eikg_, d2eikh_, d2eiki_, d2eikj_, d2eikk_, d2eikl_, d2eikm_, d2eikn_, d2eiko1, d2eiko2, d2eikq_, d2eikr_, d2eiks_, d2eikt_, d2eiku_, d2eikv_, d2eikw_, d2eikx_, d2eiky_, d2eikz_ |