Lineage for d2eikl1 (2eik L:2-47)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887289Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) (S)
  5. 887290Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (1 protein)
  6. 887291Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 887292Species Cow (Bos taurus) [TaxId:9913] [81424] (14 PDB entries)
  8. 887303Domain d2eikl1: 2eik L:2-47 [132179]
    Other proteins in same PDB: d2eika1, d2eikb1, d2eikb2, d2eikc1, d2eikd1, d2eike1, d2eikf1, d2eikg1, d2eikh1, d2eiki1, d2eikj1, d2eikk1, d2eikm1, d2eikn1, d2eiko1, d2eiko2, d2eikp1, d2eikq1, d2eikr1, d2eiks1, d2eikt1, d2eiku1, d2eikv1, d2eikw1, d2eikx1, d2eikz1
    automatically matched to d1occl_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eikl1

PDB Entry: 2eik (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (L:) Cytochrome c oxidase polypeptide VIIc

SCOP Domain Sequences for d2eikl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eikl1 f.23.6.1 (L:2-47) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

SCOP Domain Coordinates for d2eikl1:

Click to download the PDB-style file with coordinates for d2eikl1.
(The format of our PDB-style files is described here.)

Timeline for d2eikl1: