SCOP 1.73: Domain d2eikk1: 2eik K:6-54

Lineage for d2eikk1 (2eik K:6-54)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family)

5. Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81420] (14 PDB entries)

8. Domain d2eikk1: 2eik K:6-54 [132178]
   Other proteins in same PDB: d2eika1, d2eikb1, d2eikb2, d2eikc1, d2eikd1, d2eike1, d2eikf1, d2eikg1, d2eikh1, d2eiki1, d2eikj1, d2eikl1, d2eikm1, d2eikn1, d2eiko1, d2eiko2, d2eikp1, d2eikq1, d2eikr1, d2eiks1, d2eikt1, d2eiku1, d2eikv1, d2eikw1, d2eiky1, d2eikz1
   automatically matched to d1occk_
   complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eikk1

PDB Entry: 2eik, 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state

PDB Compounds: (K:) Cytochrome c oxidase polypeptide VIIb

SCOP Domain Sequences for d2eikk1:

Sequence; same for both SEQRES and ATOM records:

>d2eikk1 f.23.5.1 (K:6-54) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

Timeline for d2eikk1:

• d2eikk1 is new in SCOP 1.73
  
• d2eikk1 appears in SCOP 1.75
  
• d2eikk1 appears in the current release, SCOPe 2.08, called d2eikk_