| Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) ![]() automatically mapped to Pfam PF02937 |
| Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein) |
| Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
| Species Cow (Bos taurus) [TaxId:9913] [81412] (37 PDB entries) |
| Domain d2eiki_: 2eik I: [132176] Other proteins in same PDB: d2eika_, d2eikb1, d2eikb2, d2eikc_, d2eikd_, d2eike_, d2eikf_, d2eikg_, d2eikh_, d2eikj_, d2eikk_, d2eikl_, d2eikm_, d2eikn_, d2eiko1, d2eiko2, d2eikp_, d2eikq_, d2eikr_, d2eiks_, d2eikt_, d2eiku_, d2eikw_, d2eikx_, d2eiky_, d2eikz_ automated match to d1occi_ complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eik (more details), 2.1 Å
SCOPe Domain Sequences for d2eiki_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eiki_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak
Timeline for d2eiki_:
View in 3DDomains from other chains: (mouse over for more information) d2eika_, d2eikb1, d2eikb2, d2eikc_, d2eikd_, d2eike_, d2eikf_, d2eikg_, d2eikh_, d2eikj_, d2eikk_, d2eikl_, d2eikm_, d2eikn_, d2eiko1, d2eiko2, d2eikp_, d2eikq_, d2eikr_, d2eiks_, d2eikt_, d2eiku_, d2eikv_, d2eikw_, d2eikx_, d2eiky_, d2eikz_ |