Lineage for d2eiki_ (2eik I:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059492Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) (S)
  5. 1059493Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)
  6. 1059494Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 1059495Species Cow (Bos taurus) [TaxId:9913] [81412] (23 PDB entries)
  8. 1059522Domain d2eiki_: 2eik I: [132176]
    Other proteins in same PDB: d2eika_, d2eikb1, d2eikb2, d2eikc_, d2eikd_, d2eike_, d2eikf_, d2eikg_, d2eikh_, d2eikj_, d2eikk_, d2eikl_, d2eikm_, d2eikn_, d2eiko1, d2eiko2, d2eikp_, d2eikq_, d2eikr_, d2eiks_, d2eikt_, d2eiku_, d2eikw_, d2eikx_, d2eiky_, d2eikz_
    automated match to d1occi_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eiki_

PDB Entry: 2eik (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (I:) Cytochrome c oxidase polypeptide VIc

SCOPe Domain Sequences for d2eiki_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eiki_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak

SCOPe Domain Coordinates for d2eiki_:

Click to download the PDB-style file with coordinates for d2eiki_.
(The format of our PDB-style files is described here.)

Timeline for d2eiki_: