Lineage for d2eikh1 (2eik H:7-85)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642471Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 642472Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 642473Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)
  6. 642474Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 642475Species Cow (Bos taurus) [TaxId:9913] [47697] (14 PDB entries)
  8. 642486Domain d2eikh1: 2eik H:7-85 [132175]
    Other proteins in same PDB: d2eika1, d2eikb1, d2eikb2, d2eikc1, d2eikd1, d2eike1, d2eikf1, d2eikg1, d2eiki1, d2eikj1, d2eikk1, d2eikl1, d2eikm1, d2eikn1, d2eiko1, d2eiko2, d2eikp1, d2eikq1, d2eikr1, d2eiks1, d2eikt1, d2eikv1, d2eikw1, d2eikx1, d2eiky1, d2eikz1
    automatically matched to d1ocrh_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eikh1

PDB Entry: 2eik (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (H:) Cytochrome c oxidase subunit VIb isoform 1

SCOP Domain Sequences for d2eikh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eikh1 a.51.1.1 (H:7-85) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOP Domain Coordinates for d2eikh1:

Click to download the PDB-style file with coordinates for d2eikh1.
(The format of our PDB-style files is described here.)

Timeline for d2eikh1: