![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (40 superfamilies) not a true fold |
![]() | Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) ![]() automatically mapped to Pfam PF02046 |
![]() | Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species) probably responsible for the dimerization of the mitochondrial cytochrome c oxidase |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81408] (26 PDB entries) |
![]() | Domain d2eikg_: 2eik G: [132174] Other proteins in same PDB: d2eika_, d2eikb1, d2eikb2, d2eikc_, d2eikd_, d2eike_, d2eikf_, d2eikh_, d2eiki_, d2eikj_, d2eikk_, d2eikl_, d2eikm_, d2eikn_, d2eiko1, d2eiko2, d2eikp_, d2eikq_, d2eikr_, d2eiks_, d2eiku_, d2eikv_, d2eikw_, d2eikx_, d2eiky_, d2eikz_ automated match to d1occg_ complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eik (more details), 2.1 Å
SCOPe Domain Sequences for d2eikg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eikg_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]} asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf swgdgnhtffhnprvnplptgyek
Timeline for d2eikg_:
![]() Domains from other chains: (mouse over for more information) d2eika_, d2eikb1, d2eikb2, d2eikc_, d2eikd_, d2eike_, d2eikf_, d2eikh_, d2eiki_, d2eikj_, d2eikk_, d2eikl_, d2eikm_, d2eikn_, d2eiko1, d2eiko2, d2eikp_, d2eikq_, d2eikr_, d2eiks_, d2eikt_, d2eiku_, d2eikv_, d2eikw_, d2eikx_, d2eiky_, d2eikz_ |