Lineage for d2eikc_ (2eik C:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1238962Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 1238963Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
  5. 1238964Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 1238977Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 1238978Species Cow (Bos taurus) [TaxId:9913] [81444] (24 PDB entries)
  8. 1239007Domain d2eikc_: 2eik C: [132170]
    Other proteins in same PDB: d2eika_, d2eikb1, d2eikb2, d2eikd_, d2eike_, d2eikf_, d2eikg_, d2eikh_, d2eiki_, d2eikj_, d2eikk_, d2eikl_, d2eikm_, d2eikn_, d2eiko1, d2eiko2, d2eikq_, d2eikr_, d2eiks_, d2eikt_, d2eiku_, d2eikv_, d2eikw_, d2eikx_, d2eiky_, d2eikz_
    automated match to d1occc_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eikc_

PDB Entry: 2eik (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d2eikc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eikc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d2eikc_:

Click to download the PDB-style file with coordinates for d2eikc_.
(The format of our PDB-style files is described here.)

Timeline for d2eikc_: