Lineage for d2eikb1 (2eik B:91-227)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660834Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 660835Protein Cytochrome c oxidase [49544] (4 species)
  7. 660836Species Cow (Bos taurus) [TaxId:9913] [49545] (14 PDB entries)
  8. 660847Domain d2eikb1: 2eik B:91-227 [132168]
    Other proteins in same PDB: d2eika1, d2eikb2, d2eikc1, d2eikd1, d2eike1, d2eikf1, d2eikg1, d2eikh1, d2eiki1, d2eikj1, d2eikk1, d2eikl1, d2eikm1, d2eikn1, d2eiko2, d2eikp1, d2eikq1, d2eikr1, d2eiks1, d2eikt1, d2eiku1, d2eikv1, d2eikw1, d2eikx1, d2eiky1, d2eikz1
    automatically matched to d1occb1
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eikb1

PDB Entry: 2eik (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOP Domain Sequences for d2eikb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eikb1 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOP Domain Coordinates for d2eikb1:

Click to download the PDB-style file with coordinates for d2eikb1.
(The format of our PDB-style files is described here.)

Timeline for d2eikb1: