Lineage for d2eijy1 (2eij Y:2-47)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 745694Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) (S)
  5. 745695Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (1 protein)
  6. 745696Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 745697Species Cow (Bos taurus) [TaxId:9913] [81424] (14 PDB entries)
  8. 745705Domain d2eijy1: 2eij Y:2-47 [132165]
    Other proteins in same PDB: d2eija1, d2eijb1, d2eijb2, d2eijc1, d2eijd1, d2eije1, d2eijf1, d2eijg1, d2eijh1, d2eiji1, d2eijj1, d2eijk1, d2eijm1, d2eijn1, d2eijo1, d2eijo2, d2eijp1, d2eijq1, d2eijr1, d2eijs1, d2eijt1, d2eiju1, d2eijv1, d2eijw1, d2eijx1, d2eijz1
    automatically matched to d1occl_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eijy1

PDB Entry: 2eij (more details), 1.9 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (Y:) Cytochrome c oxidase polypeptide VIIc

SCOP Domain Sequences for d2eijy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eijy1 f.23.6.1 (Y:2-47) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

SCOP Domain Coordinates for d2eijy1:

Click to download the PDB-style file with coordinates for d2eijy1.
(The format of our PDB-style files is described here.)

Timeline for d2eijy1: