Lineage for d2eijx_ (2eij X:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238177Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
  5. 1238178Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 1238195Protein automated matches [190272] (1 species)
    not a true protein
  7. 1238196Species Cow (Bos taurus) [TaxId:9913] [187064] (16 PDB entries)
  8. 1238206Domain d2eijx_: 2eij X: [132164]
    Other proteins in same PDB: d2eija_, d2eijb1, d2eijb2, d2eijc_, d2eijd_, d2eije_, d2eijf_, d2eijg_, d2eijh_, d2eiji_, d2eijj_, d2eijl_, d2eijm_, d2eijn_, d2eijo1, d2eijo2, d2eijp_, d2eijq_, d2eijr_, d2eijs_, d2eijt_, d2eiju_, d2eijv_, d2eijw_, d2eijy_, d2eijz_
    automated match to d1occk_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eijx_

PDB Entry: 2eij (more details), 1.9 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (X:) Cytochrome c oxidase polypeptide VIIb

SCOPe Domain Sequences for d2eijx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eijx_ f.23.5.1 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d2eijx_:

Click to download the PDB-style file with coordinates for d2eijx_.
(The format of our PDB-style files is described here.)

Timeline for d2eijx_: